Web Analysis for Multiracialmanifesto - multiracialmanifesto.com
multiracialmanifesto.com is 1 decade 5 months old. It is a domain having com extension. It has a global traffic rank of #15629670 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. Furthermore the website is monetizing from Google Adsense. As no active threats were reported recently by users, multiracialmanifesto.com is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | 31 |
Daily Pageviews: | 62 |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Not Applicable |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | 15,629,670 |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | Not Applicable | H2 Headings: | 38 |
H3 Headings: | 3 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 27 |
Google Adsense: | pub-8530026629590651 | Google Analytics: | UA-46299140-1 |
Websites Hosted on Same IP (i.e. 74.220.219.69)
Îðàòîðñêîå èñêóññòâî ðå÷è, êàê âûñòóïàòü íà ïóáëèêå, êàê ñòàòü óñïåøíû
Íå óâåðåííî âûõîäèøü íà ïóáëèêó èëè áîèøüñÿ ïðîâîäèòü ïðåçåíòàöèþ? Ïîäïèøèñü íà âèäåî êóðñ è òû íå âñïîìíèøü î ñâîèõ ñòðàõàõ.Õî÷åøü óäèâèòü ðóêîâîäèòåëÿ, è îáúÿñíèòü áåç çàïèíîê? Òîãäà âàì íà íàø ñàéò.
Strategic Acquisitions Group | We Acquire Established Businesses in th
Web hosting provider - Bluehost.com - domain hosting - PHP Hosting - c
Bluehost - Top rated web hosting provider - Free 1 click installs For blogs, shopping carts, and more. Get a free domain name, real NON-outsourced 24/7 support, and superior speed. web hosting provider php hosting cheap web hosting, Web hosting, domain names, front page hosting, email hosting. We offer affordable hosti
Web hosting provider - Bluehost.com - domain hosting - PHP Hosting - c
Bluehost - Top rated web hosting provider - Free 1 click installs For blogs, shopping carts, and more. Get a free domain name, real NON-outsourced 24/7 support, and superior speed. web hosting provider php hosting cheap web hosting, Web hosting, domain names, front page hosting, email hosting. We offer affordable hosti
HTTP Header Analysis
Date: Sun, 05 Jan 2014 11:17:03 GMT
Server: Apache
X-Pingback: http://multiracialmanifesto.com/xmlrpc.php
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 8248
Content-Type: text/html; charset=UTF-8
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
ns1.bluehost.com | 162.159.24.80 | United States of America | |
ns2.bluehost.com | 162.159.25.175 | United States of America |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
multiracialmanifesto.com | A | 14389 |
IP: 74.220.219.69 |
multiracialmanifesto.com | NS | 86400 |
Target: ns2.bluehost.com |
multiracialmanifesto.com | NS | 86400 |
Target: ns1.bluehost.com |
multiracialmanifesto.com | SOA | 86400 |
MNAME: ns1.bluehost.com RNAME: root.box469.bluehost.com Serial: 2013120907 Refresh: 86400 Retry: 7200 Expire: 3600000 Minimum TTL: 300 |
multiracialmanifesto.com | MX | 14400 |
Target: mail.multiracialmanifesto.com |
multiracialmanifesto.com | TXT | 14400 |
TXT: v=spf1 a mx ptr include:bluehost.com ?all |
Similarly Ranked Websites
Ghost Hunts, Hunting Ghosts, Haunted Events, Ghost Hunt, Ghost Tours,
Specialists in ghost hunts, ghost tour overnight ghost hunts and psychic nights
Catholic, Orthodox, Free | An Online Source for Catholic Catechesis
The Saint Jerome Center for Catechesis (SJCC) is a catechetical website dedicated to providing Catholics and non-Catholics with free material about the Catholic faith. The SJCC is faithful to the Magisterium of the Catholic Church and is committed to defending Catholic orthodoxy in all matters of faith and morals. Watc
yaptatadiyamankervansaraykahve.net | Isimtescil.net | Ücretsiz yapım a
Full WHOIS Lookup
to you by BlueHost.Com for information purposes only,
that is, to assist you in obtaining information about or related to
a domain name registration record. BlueHost.Com makes
this information available "as is," and does not guarantee its
accuracy. By submitting a WHOIS query, you agree that you will use
this data only for lawful purposes and that, under no circumstances
will you use this data to: (1) allow, enable, or otherwise support
the transmission of mass unsolicited, commercial advertising or
solicitations via direct mail, electronic mail, or by telephone; or
(2) enable high volume, automated, electronic processes that apply
to BlueHost.Com (or its systems). The compilation,
repackaging, dissemination or other use of this data is expressly
prohibited without the prior written consent of
BlueHost.Com. BlueHost.Com reserves the
right to modify these terms at any time. By submitting this query,
you agree to abide by these terms.
=-=-=-=
Registrar: FastDomain Inc.
Provider Name....: BlueHost.Com
Provider Whois...: whois.bluehost.com
Provider Homepage: http://www.bluehost.com/
Domain Name: MULTIRACIALMANIFESTO.COM
Created on..............: 2013-12-09 00:56:27 GMT
Expires on..............: 2014-12-09 00:56:27 GMT
Last modified on........: 2013-12-09 00:56:27 GMT
Registrant Info: (FAST-20690455)
Domain Privacy Service FBO Registrant
1958 South 950 East
Provo, Utah 84606
United States
Phone: +1.8017659400
Fax..:
Email: whois@bluehost.com
Last modified: 2013-11-14 17:19:37 GMT
Administrative Info: (FAST-20690455)
Domain Privacy Service FBO Registrant
1958 South 950 East
Provo, Utah 84606
United States
Phone: +1.8017659400
Fax..:
Email: whois@bluehost.com
Last modified: 2013-11-14 17:19:37 GMT
Technical Info: (FAST-20690455)
Domain Privacy Service FBO Registrant
1958 South 950 East
Provo, Utah 84606
United States
Phone: +1.8017659400
Fax..:
Email: whois@bluehost.com
Last modified: 2013-11-14 17:19:37 GMT
Status: Locked
Domain servers in listed order:
NS1.BLUEHOST.COM
NS2.BLUEHOST.COM
=-=-=-=
UNLIMITED storage, bandwidth and domains on one account. Also receive a *FREE* domain for one year when you host with http://www.bluehost.com/