1.67 Rating by CuteStat

multiracialmanifesto.com is 1 decade 5 months old. It is a domain having com extension. It has a global traffic rank of #15629670 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. Furthermore the website is monetizing from Google Adsense. As no active threats were reported recently by users, multiracialmanifesto.com is SAFE to browse.

PageSpeed Score
78
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 31
Daily Pageviews: 62

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 15,629,670
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

74.220.219.69

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822
Multiracial Manifesto | Mixed Race Discussion, Issues & Lifestyle

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 38
H3 Headings: 3 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 27
Google Adsense: pub-8530026629590651 Google Analytics: UA-46299140-1

Websites Hosted on Same IP (i.e. 74.220.219.69)

Îðàòîðñêîå èñêóññòâî ðå÷è, êàê âûñòóïàòü íà ïóáëèêå, êàê ñòàòü óñïåøíû

- semaeva-bravo.ru

Íå óâåðåííî âûõîäèøü íà ïóáëèêó èëè áîèøüñÿ ïðîâîäèòü ïðåçåíòàöèþ? Ïîäïèøèñü íà âèäåî êóðñ è òû íå âñïîìíèøü î ñâîèõ ñòðàõàõ.Õî÷åøü óäèâèòü ðóêîâîäèòåëÿ, è îáúÿñíèòü áåç çàïèíîê? Òîãäà âàì íà íàø ñàéò.

1,562,851 $ 480.00

SMS Collection

- smscollection.org
1,503,041 $ 480.00

Strategic Acquisitions Group | We Acquire Established Businesses in th

- strategicacquisitionsgroup.com
Not Applicable $ 8.95

Web hosting provider - Bluehost.com - domain hosting - PHP Hosting - c

- digitalmakeupitalia.com

Bluehost - Top rated web hosting provider - Free 1 click installs For blogs, shopping carts, and more. Get a free domain name, real NON-outsourced 24/7 support, and superior speed. web hosting provider php hosting cheap web hosting, Web hosting, domain names, front page hosting, email hosting. We offer affordable hosti

Not Applicable $ 8.95

Web hosting provider - Bluehost.com - domain hosting - PHP Hosting - c

- amitheresa.com

Bluehost - Top rated web hosting provider - Free 1 click installs For blogs, shopping carts, and more. Get a free domain name, real NON-outsourced 24/7 support, and superior speed. web hosting provider php hosting cheap web hosting, Web hosting, domain names, front page hosting, email hosting. We offer affordable hosti

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sun, 05 Jan 2014 11:17:03 GMT
Server: Apache
X-Pingback: http://multiracialmanifesto.com/xmlrpc.php
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 8248
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: FastDomain Inc.
Registration Date: Dec 9, 2013, 12:00 AM 1 decade 5 months 4 days ago
Last Modified: Dec 9, 2013, 12:00 AM 1 decade 5 months 4 days ago
Expiration Date: Dec 9, 2014, 12:00 AM 9 years 5 months 3 days ago
Domain Status:
Locked
Owner's E-Mail: whois@bluehost.com

Domain Nameserver Information

Host IP Address Country
ns1.bluehost.com 162.159.24.80 United States of America United States of America
ns2.bluehost.com 162.159.25.175 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
multiracialmanifesto.com A 14389 IP: 74.220.219.69
multiracialmanifesto.com NS 86400 Target: ns2.bluehost.com
multiracialmanifesto.com NS 86400 Target: ns1.bluehost.com
multiracialmanifesto.com SOA 86400 MNAME: ns1.bluehost.com
RNAME: root.box469.bluehost.com
Serial: 2013120907
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 300
multiracialmanifesto.com MX 14400 Target: mail.multiracialmanifesto.com
multiracialmanifesto.com TXT 14400 TXT: v=spf1 a mx ptr include:bluehost.com
?all

Similarly Ranked Websites

Dekor Mobel -

- mobelbesten.com
15,629,697 $ 8.95

Ghost Hunts, Hunting Ghosts, Haunted Events, Ghost Hunt, Ghost Tours,

- ultimateparanormalexperience.co.uk

Specialists in ghost hunts, ghost tour overnight ghost hunts and psychic nights

15,629,726 $ 8.95

Catholic, Orthodox, Free | An Online Source for Catholic Catechesis

- saintjeromecenter.com

The Saint Jerome Center for Catechesis (SJCC) is a catechetical website dedicated to providing Catholics and non-Catholics with free material about the Catholic faith. The SJCC is faithful to the Magisterium of the Catholic Church and is committed to defending Catholic orthodoxy in all matters of faith and morals. Watc

15,629,760 $ 8.95

yaptatadiyamankervansaraykahve.net | Isimtescil.net | Ücretsiz yapım a

- yaptatadiyamankervansaraykahve.net
15,629,791 $ 8.95

nanex.exchange - Registered at Namecheap.com

- nanex.exchange
15,629,834 $ 8.95

Full WHOIS Lookup

The data in the BlueHost.Com WHOIS database is provided
to you by BlueHost.Com for information purposes only,
that is, to assist you in obtaining information about or related to
a domain name registration record. BlueHost.Com makes
this information available "as is," and does not guarantee its
accuracy. By submitting a WHOIS query, you agree that you will use
this data only for lawful purposes and that, under no circumstances
will you use this data to: (1) allow, enable, or otherwise support
the transmission of mass unsolicited, commercial advertising or
solicitations via direct mail, electronic mail, or by telephone; or
(2) enable high volume, automated, electronic processes that apply
to BlueHost.Com (or its systems). The compilation,
repackaging, dissemination or other use of this data is expressly
prohibited without the prior written consent of
BlueHost.Com. BlueHost.Com reserves the
right to modify these terms at any time. By submitting this query,
you agree to abide by these terms.

=-=-=-=

Registrar: FastDomain Inc.
Provider Name....: BlueHost.Com
Provider Whois...: whois.bluehost.com
Provider Homepage: http://www.bluehost.com/

Domain Name: MULTIRACIALMANIFESTO.COM

Created on..............: 2013-12-09 00:56:27 GMT
Expires on..............: 2014-12-09 00:56:27 GMT
Last modified on........: 2013-12-09 00:56:27 GMT

Registrant Info: (FAST-20690455)

Domain Privacy Service FBO Registrant
1958 South 950 East
Provo, Utah 84606
United States
Phone: +1.8017659400
Fax..:
Email: whois@bluehost.com
Last modified: 2013-11-14 17:19:37 GMT

Administrative Info: (FAST-20690455)

Domain Privacy Service FBO Registrant
1958 South 950 East
Provo, Utah 84606
United States
Phone: +1.8017659400
Fax..:
Email: whois@bluehost.com
Last modified: 2013-11-14 17:19:37 GMT

Technical Info: (FAST-20690455)

Domain Privacy Service FBO Registrant
1958 South 950 East
Provo, Utah 84606
United States
Phone: +1.8017659400
Fax..:
Email: whois@bluehost.com
Last modified: 2013-11-14 17:19:37 GMT

Status: Locked

Domain servers in listed order:

NS1.BLUEHOST.COM
NS2.BLUEHOST.COM
=-=-=-=

UNLIMITED storage, bandwidth and domains on one account. Also receive a *FREE* domain for one year when you host with http://www.bluehost.com/